PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009962-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 207aa    MW: 23856.5 Da    PI: 7.9563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009962-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+ +W++++   g+ R+ k+c++rw +yl
  AHYPO_009962-RA 14 KGPWTPEEDIILVSYIQQHGPANWRSVPTNTGLQRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.87e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  AHYPO_009962-RA  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.788965IPR017930Myb domain
SuperFamilySSF466891.99E-3011108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001674.52E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2565117IPR009057Homeodomain-like
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.7566116IPR017930Myb domain
PfamPF002492.7E-1367112IPR001005SANT/Myb domain
CDDcd001676.85E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MGRPPCCDKD GIKKGPWTPE EDIILVSYIQ QHGPANWRSV PTNTGLQRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKRAN  120
LDDNNNNNND NDNNNNNNNN NNNNNNYGSY TETILSFRNL VNNKIADTIT KEDEEENNPP  180
LTFLEKWLLD ESTMSRDEVL RLPTIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0945321e-149EU094532.1 Amaranthus hypochondriacus clone AHAAT031 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172358.12e-85putative transcription factor MYB60
SwissprotQ9SCU73e-79MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A068UWH92e-90A0A068UWH9_COFCA; Uncharacterized protein
STRINGAT1G08810.16e-85(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.15e-84myb domain protein 60